Anti KIAA0368 pAb (ATL-HPA059795)
Atlas Antibodies
- SKU:
- ATL-HPA059795-25
- Shipping:
- Calculated at Checkout
$395.00
Product Description
Protein Description: KIAA0368
Gene Name: KIAA0368
Alternative Gene Name: ECM29, FLJ22036
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050812: 98%, ENSRNOG00000025076: 98%
Entrez Gene ID: 23392
Uniprot ID: Q5VYK3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: KIAA0368
Alternative Gene Name: ECM29, FLJ22036
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050812: 98%, ENSRNOG00000025076: 98%
Entrez Gene ID: 23392
Uniprot ID: Q5VYK3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GVGLGTKGGCASVIVSLTTQCPQDLTPYSGKLMSALLSGLTDRNSVIQKSCAFAMGHLVRTSRDSSTEKLLQKLNGWYMEKEEPIYKTSCALTIHAIGRYSPDVLKNHAKEVL |
Gene Sequence | GVGLGTKGGCASVIVSLTTQCPQDLTPYSGKLMSALLSGLTDRNSVIQKSCAFAMGHLVRTSRDSSTEKLLQKLNGWYMEKEEPIYKTSCALTIHAIGRYSPDVLKNHAKEVL |
Gene ID - Mouse | ENSMUSG00000050812 |
Gene ID - Rat | ENSRNOG00000025076 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti KIAA0368 pAb (ATL-HPA059795) | |
Datasheet | Anti KIAA0368 pAb (ATL-HPA059795) Datasheet (External Link) |
Vendor Page | Anti KIAA0368 pAb (ATL-HPA059795) at Atlas Antibodies |
Documents & Links for Anti KIAA0368 pAb (ATL-HPA059795) | |
Datasheet | Anti KIAA0368 pAb (ATL-HPA059795) Datasheet (External Link) |
Vendor Page | Anti KIAA0368 pAb (ATL-HPA059795) |