Anti KIAA0368 pAb (ATL-HPA059795)

Atlas Antibodies

SKU:
ATL-HPA059795-25
  • Immunohistochemical staining of human caudate shows strong cytoplasmic and membranous positivity in astrocytes.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added

Product Description

Protein Description: KIAA0368
Gene Name: KIAA0368
Alternative Gene Name: ECM29, FLJ22036
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050812: 98%, ENSRNOG00000025076: 98%
Entrez Gene ID: 23392
Uniprot ID: Q5VYK3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GVGLGTKGGCASVIVSLTTQCPQDLTPYSGKLMSALLSGLTDRNSVIQKSCAFAMGHLVRTSRDSSTEKLLQKLNGWYMEKEEPIYKTSCALTIHAIGRYSPDVLKNHAKEVL
Gene Sequence GVGLGTKGGCASVIVSLTTQCPQDLTPYSGKLMSALLSGLTDRNSVIQKSCAFAMGHLVRTSRDSSTEKLLQKLNGWYMEKEEPIYKTSCALTIHAIGRYSPDVLKNHAKEVL
Gene ID - Mouse ENSMUSG00000050812
Gene ID - Rat ENSRNOG00000025076
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti KIAA0368 pAb (ATL-HPA059795)
Datasheet Anti KIAA0368 pAb (ATL-HPA059795) Datasheet (External Link)
Vendor Page Anti KIAA0368 pAb (ATL-HPA059795) at Atlas Antibodies

Documents & Links for Anti KIAA0368 pAb (ATL-HPA059795)
Datasheet Anti KIAA0368 pAb (ATL-HPA059795) Datasheet (External Link)
Vendor Page Anti KIAA0368 pAb (ATL-HPA059795)