Anti KHDRBS1 pAb (ATL-HPA051280 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA051280-25

• 
• 
• 

Protein Description: KH domain containing, RNA binding, signal transduction associated 1
Gene Name: KHDRBS1
Alternative Gene Name: FLJ34027, p62, Sam68
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028790: 97%, ENSRNOG00000046794: 95%
Entrez Gene ID: 10657
Uniprot ID: Q07666
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YDDTYAEQSYEGYEGYYSQSQGDSEYYDYGHGEVQDSYEAYGQDDWNGTRPSLKAPPARPVKGAYR
• Gene Sequence: YDDTYAEQSYEGYEGYYSQSQGDSEYYDYGHGEVQDSYEAYGQDDWNGTRPSLKAPPARPVKGAYR
• Gene ID - Mouse: ENSMUSG00000028790
• Gene ID - Rat: ENSRNOG00000046794
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.