Anti KDM6A pAb (ATL-HPA002111 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA002111-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: lysine (K)-specific demethylase 6A
Gene Name: KDM6A
Alternative Gene Name: UTX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037369: 95%, ENSRNOG00000052721: 94%
Entrez Gene ID: 7403
Uniprot ID: O15550
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IGNNHITGSGSNGNVPYLQRNALTLPHNRTNLTSSAEEPWKNQLSNSTQGLHKGQSSHSAGPNGERPLSSTGPSQHLQAAGSGIQNQNGHPTLPSNSVTQGAALNHLSSHTATSGGQQGITLTKESKPSGNILTVPETSRHT
Gene Sequence IGNNHITGSGSNGNVPYLQRNALTLPHNRTNLTSSAEEPWKNQLSNSTQGLHKGQSSHSAGPNGERPLSSTGPSQHLQAAGSGIQNQNGHPTLPSNSVTQGAALNHLSSHTATSGGQQGITLTKESKPSGNILTVPETSRHT
Gene ID - Mouse ENSMUSG00000037369
Gene ID - Rat ENSRNOG00000052721
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti KDM6A pAb (ATL-HPA002111 w/enhanced validation)
Datasheet Anti KDM6A pAb (ATL-HPA002111 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti KDM6A pAb (ATL-HPA002111 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti KDM6A pAb (ATL-HPA002111 w/enhanced validation)
Datasheet Anti KDM6A pAb (ATL-HPA002111 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti KDM6A pAb (ATL-HPA002111 w/enhanced validation)
Citations for Anti KDM6A pAb (ATL-HPA002111 w/enhanced validation) – 3 Found
Olpe, Cora; Khamis, Doran; Chukanova, Maria; Skoufou-Papoutsaki, Nefeli; Kemp, Richard; Marks, Kate; Tatton, Cerys; Lindskog, Cecilia; Nicholson, Anna; Brunton-Sim, Roxanne; Malhotra, Shalini; Ten Hoopen, Rogier; Stanley, Rachael; Winton, Douglas J; Morrissey, Edward. A Diffusion-like Process Accommodates New Crypts During Clonal Expansion in Human Colonic Epithelium. Gastroenterology. 2021;161(2):548-559.e23.  PubMed
Yoo, Kyung Hyun; Oh, Sumin; Kang, Keunsoo; Wang, Chaochen; Robinson, Gertraud W; Ge, Kai; Hennighausen, Lothar. Histone Demethylase KDM6A Controls the Mammary Luminal Lineage through Enzyme-Independent Mechanisms. Molecular And Cellular Biology. 2016;36(16):2108-20.  PubMed
Ramakrishnan, Swathi; Granger, Victoria; Rak, Monika; Hu, Qiang; Attwood, Kristopher; Aquila, Lanni; Krishnan, Nithya; Osiecki, Rafal; Azabdaftari, Gissou; Guru, Khurshid; Chatta, Gurkamal; Gueron, Geraldine; McNally, Lacey; Ohm, Joyce; Wang, Jianmin; Woloszynska, Anna. Inhibition of EZH2 induces NK cell-mediated differentiation and death in muscle-invasive bladder cancer. Cell Death And Differentiation. 2019;26(10):2100-2114.  PubMed