Protein Description: lysine (K)-specific demethylase 4B
Gene Name: KDM4B
Alternative Gene Name: JMJD2B, KIAA0876, TDRD14B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024201: 70%, ENSRNOG00000049221: 74%
Entrez Gene ID: 23030
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: KDM4B
Alternative Gene Name: JMJD2B, KIAA0876, TDRD14B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024201: 70%, ENSRNOG00000049221: 74%
Entrez Gene ID: 23030
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | SRLSLSTGAPQEPAFSGEEAKAAKRPRVGTPLATEDSGRSQDYVAFVESLLQVQG |
Documents & Links for Anti KDM4B pAb (ATL-HPA062872) | |
Datasheet | Anti KDM4B pAb (ATL-HPA062872) Datasheet (External Link) |
Vendor Page | Anti KDM4B pAb (ATL-HPA062872) at Atlas |
Documents & Links for Anti KDM4B pAb (ATL-HPA062872) | |
Datasheet | Anti KDM4B pAb (ATL-HPA062872) Datasheet (External Link) |
Vendor Page | Anti KDM4B pAb (ATL-HPA062872) |