Anti KCTD9 pAb (ATL-HPA047902)

Atlas Antibodies

SKU:
ATL-HPA047902-25
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: potassium channel tetramerization domain containing 9
Gene Name: KCTD9
Alternative Gene Name: BTBD27, FLJ20038
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034327: 92%, ENSRNOG00000012951: 92%
Entrez Gene ID: 54793
Uniprot ID: Q7L273
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NCDLCGCDLQEANLRGSNMKGAIFEEMLTPLYMSQSV
Gene Sequence NCDLCGCDLQEANLRGSNMKGAIFEEMLTPLYMSQSV
Gene ID - Mouse ENSMUSG00000034327
Gene ID - Rat ENSRNOG00000012951
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti KCTD9 pAb (ATL-HPA047902)
Datasheet Anti KCTD9 pAb (ATL-HPA047902) Datasheet (External Link)
Vendor Page Anti KCTD9 pAb (ATL-HPA047902) at Atlas Antibodies

Documents & Links for Anti KCTD9 pAb (ATL-HPA047902)
Datasheet Anti KCTD9 pAb (ATL-HPA047902) Datasheet (External Link)
Vendor Page Anti KCTD9 pAb (ATL-HPA047902)