Anti KCTD19 pAb (ATL-HPA049310)

Atlas Antibodies

SKU: ATL-HPA049310-25

• 

Protein Description: potassium channel tetramerization domain containing 19
Gene Name: KCTD19
Alternative Gene Name: FLJ40162
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051648: 85%, ENSRNOG00000016760: 88%
Entrez Gene ID: 146212
Uniprot ID: Q17RG1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GVILKVTHPPVVGSDGFCMFFEDSIIYTTEMDNLRHTTPTASPQPQEVTFLSFSLSWEEMFYAQKCHCFLADIIMDSIRQKDPKAITAKVVSLANRLWTLHISPKQF
• Gene Sequence: GVILKVTHPPVVGSDGFCMFFEDSIIYTTEMDNLRHTTPTASPQPQEVTFLSFSLSWEEMFYAQKCHCFLADIIMDSIRQKDPKAITAKVVSLANRLWTLHISPKQF
• Gene ID - Mouse: ENSMUSG00000051648
• Gene ID - Rat: ENSRNOG00000016760
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.