Anti KCTD11 pAb (ATL-HPA052035)

Atlas Antibodies

Catalog No.: ATL-HPA052035-25

Protein Description: potassium channel tetramerization domain containing 11
Gene Name: KCTD11
Alternative Gene Name: C17orf36, KCASH1, REN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046731: 89%, ENSRNOG00000015669: 92%
Entrez Gene ID: 147040
Uniprot ID: Q693B1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DALRELEASQGTPAPTAALLHADVDVSPRLVHFSARRGPHHYELSSVQVDTFRANLFCTDSECLGALRARFGVAS
• Gene Sequence: DALRELEASQGTPAPTAALLHADVDVSPRLVHFSARRGPHHYELSSVQVDTFRANLFCTDSECLGALRARFGVAS
• Gene ID - Mouse: ENSMUSG00000046731
• Gene ID - Rat: ENSRNOG00000015669
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.