Anti KCNT2 pAb (ATL-HPA051218)

Atlas Antibodies

SKU: ATL-HPA051218-25

• 
• 

Protein Description: potassium channel, subfamily T, member 2
Gene Name: KCNT2
Alternative Gene Name: KCa4.2, SLICK, SLO2.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052726: 93%, ENSRNOG00000013312: 93%
Entrez Gene ID: 343450
Uniprot ID: Q6UVM3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GIYRTESQKLTTSESQISISVEEWEDTKDSKEQGHHRSNHRNSTSSDQSDHPLLRR
• Gene Sequence: GIYRTESQKLTTSESQISISVEEWEDTKDSKEQGHHRSNHRNSTSSDQSDHPLLRR
• Gene ID - Mouse: ENSMUSG00000052726
• Gene ID - Rat: ENSRNOG00000013312
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.