Anti KCNS3 pAb (ATL-HPA014864)
Atlas Antibodies
- SKU:
- ATL-HPA014864-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: KCNS3
Alternative Gene Name: Kv9.3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043673: 84%, ENSRNOG00000004899: 86%
Entrez Gene ID: 3790
Uniprot ID: Q9BQ31
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KDIDVDQCSEDAPEKCHELPYFNIRDIYAQRMHAFITSLSSVGIVVSDPDSTDASSIEDNEDICNTTSLENCTA |
| Gene Sequence | KDIDVDQCSEDAPEKCHELPYFNIRDIYAQRMHAFITSLSSVGIVVSDPDSTDASSIEDNEDICNTTSLENCTA |
| Gene ID - Mouse | ENSMUSG00000043673 |
| Gene ID - Rat | ENSRNOG00000004899 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti KCNS3 pAb (ATL-HPA014864) | |
| Datasheet | Anti KCNS3 pAb (ATL-HPA014864) Datasheet (External Link) |
| Vendor Page | Anti KCNS3 pAb (ATL-HPA014864) at Atlas Antibodies |
| Documents & Links for Anti KCNS3 pAb (ATL-HPA014864) | |
| Datasheet | Anti KCNS3 pAb (ATL-HPA014864) Datasheet (External Link) |
| Vendor Page | Anti KCNS3 pAb (ATL-HPA014864) |
| Citations for Anti KCNS3 pAb (ATL-HPA014864) – 1 Found |
| Fu, L C; Lv, Y; Zhong, Y; He, Q; Liu, X; Du, L Z. Tyrosine phosphorylation of Kv1.5 is upregulated in intrauterine growth retardation rats with exaggerated pulmonary hypertension. Brazilian Journal Of Medical And Biological Research = Revista Brasileira De Pesquisas Medicas E Biologicas. 2017;50(11):e6237. PubMed |