Anti KCNS2 pAb (ATL-HPA051417)

Atlas Antibodies

SKU: ATL-HPA051417-25

• 

Protein Description: potassium voltage-gated channel, delayed-rectifier, subfamily S, member 2
Gene Name: KCNS2
Alternative Gene Name: Kv9.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050963: 89%, ENSRNOG00000011369: 89%
Entrez Gene ID: 3788
Uniprot ID: Q9ULS6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MTGQSLWDVSEANVEDGEIRINVGGFKRRLRSHTLLRF
• Gene Sequence: MTGQSLWDVSEANVEDGEIRINVGGFKRRLRSHTLLRF
• Gene ID - Mouse: ENSMUSG00000050963
• Gene ID - Rat: ENSRNOG00000011369
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.