Anti KCNN3 pAb (ATL-HPA057127)

Atlas Antibodies

SKU: ATL-HPA057127-25

• 

Protein Description: potassium channel, calcium activated intermediate/small conductance subfamily N alpha, member 3
Gene Name: KCNN3
Alternative Gene Name: hSK3, KCa2.3, SKCA3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000794: 95%, ENSRNOG00000020706: 95%
Entrez Gene ID: 3782
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NLIEAETEGQPLQLFSPSNPPEIVISSREDNHAHQTLLHHPNATHNHQHAGTTASSTTFPKANKRK
• Gene Sequence: NLIEAETEGQPLQLFSPSNPPEIVISSREDNHAHQTLLHHPNATHNHQHAGTTASSTTFPKANKRK
• Gene ID - Mouse: ENSMUSG00000000794
• Gene ID - Rat: ENSRNOG00000020706
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.