Anti KCNK5 pAb (ATL-HPA059148)

Atlas Antibodies

SKU:
ATL-HPA059148-25
  • Immunohistochemical staining of human kidney shows positivity in a subset of renal tubules.
  • Immunofluorescent staining of human cell line MCF7 shows localization to nucleus.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: potassium channel, subfamily K, member 5
Gene Name: KCNK5
Alternative Gene Name: K2p5.1, TASK-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023243: 75%, ENSRNOG00000047005: 73%
Entrez Gene ID: 8645
Uniprot ID: O95279
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VPLVVYSKNRVPTLEEVSQTLRSKGHVSRSPDEEAVARAPEDSSPAPEVFMNQLDRISEECEPWDAQDYHPLI
Gene Sequence VPLVVYSKNRVPTLEEVSQTLRSKGHVSRSPDEEAVARAPEDSSPAPEVFMNQLDRISEECEPWDAQDYHPLI
Gene ID - Mouse ENSMUSG00000023243
Gene ID - Rat ENSRNOG00000047005
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti KCNK5 pAb (ATL-HPA059148)
Datasheet Anti KCNK5 pAb (ATL-HPA059148) Datasheet (External Link)
Vendor Page Anti KCNK5 pAb (ATL-HPA059148) at Atlas Antibodies

Documents & Links for Anti KCNK5 pAb (ATL-HPA059148)
Datasheet Anti KCNK5 pAb (ATL-HPA059148) Datasheet (External Link)
Vendor Page Anti KCNK5 pAb (ATL-HPA059148)