Anti KCNH3 pAb (ATL-HPA051088)

Atlas Antibodies

SKU: ATL-HPA051088-25

• 
• 

Protein Description: potassium voltage-gated channel, subfamily H (eag-related), member 3
Gene Name: KCNH3
Alternative Gene Name: BEC1, elk2, Kv12.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037579: 96%, ENSRNOG00000057315: 95%
Entrez Gene ID: 23416
Uniprot ID: Q9ULD8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EVDTSSLSGDNTLMSTLEEKETDGEQGPTVSPAPADEPSSPLLSPGCTSSSSAAKLLSPRRTAPRPRLGGRGRPGRAGALK
• Gene Sequence: EVDTSSLSGDNTLMSTLEEKETDGEQGPTVSPAPADEPSSPLLSPGCTSSSSAAKLLSPRRTAPRPRLGGRGRPGRAGALK
• Gene ID - Mouse: ENSMUSG00000037579
• Gene ID - Rat: ENSRNOG00000057315
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.