Anti KCNE2 pAb (ATL-HPA051553 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA051553-25

• 

Protein Description: potassium voltage-gated channel, Isk-related family, member 2
Gene Name: KCNE2
Alternative Gene Name: LQT6, MiRP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039672: 87%, ENSRNOG00000029811: 83%
Entrez Gene ID: 9992
Uniprot ID: Q9Y6J6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: STVKSKRREHSNDPYHQYIVEDWQEKYKSQILNLEESKATIHENIGAAGFKMS
• Gene Sequence: STVKSKRREHSNDPYHQYIVEDWQEKYKSQILNLEESKATIHENIGAAGFKMS
• Gene ID - Mouse: ENSMUSG00000039672
• Gene ID - Rat: ENSRNOG00000029811
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.