Anti KBTBD6 pAb (ATL-HPA048914)

Atlas Antibodies

SKU: ATL-HPA048914-100

• 
• 

Protein Description: kelch repeat and BTB (POZ) domain containing 6
Gene Name: KBTBD6
Alternative Gene Name: DKFZp547E1912
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075502: 97%, ENSRNOG00000047604: 98%
Entrez Gene ID: 89890
Uniprot ID: Q86V97
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TGPEELKDTAHSAALLAQLKSFYDARLLCDVTIEVVTPGSGPGTGRLFPCNRNVLAAACPYFKSM
• Gene Sequence: TGPEELKDTAHSAALLAQLKSFYDARLLCDVTIEVVTPGSGPGTGRLFPCNRNVLAAACPYFKSM
• Gene ID - Mouse: ENSMUSG00000075502
• Gene ID - Rat: ENSRNOG00000047604
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.