Anti KBTBD6 pAb (ATL-HPA046861)

Atlas Antibodies

SKU:
ATL-HPA046861-25
  • Immunohistochemical staining of human cerebellum shows strong nuclear positivity in Purkinje cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: kelch repeat and BTB (POZ) domain containing 6
Gene Name: KBTBD6
Alternative Gene Name: DKFZp547E1912
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043881: 80%, ENSRNOG00000047604: 80%
Entrez Gene ID: 89890
Uniprot ID: Q86V97
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TVCHVAVQWLEAAPKERGPSAAEVFKCVRWMHFTEEDQDYLEGLLTKPIVKKYCLDVIEGALQMRYGDLLYKSLVPVPNSSSSSSS
Gene Sequence TVCHVAVQWLEAAPKERGPSAAEVFKCVRWMHFTEEDQDYLEGLLTKPIVKKYCLDVIEGALQMRYGDLLYKSLVPVPNSSSSSSS
Gene ID - Mouse ENSMUSG00000043881
Gene ID - Rat ENSRNOG00000047604
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti KBTBD6 pAb (ATL-HPA046861)
Datasheet Anti KBTBD6 pAb (ATL-HPA046861) Datasheet (External Link)
Vendor Page Anti KBTBD6 pAb (ATL-HPA046861) at Atlas Antibodies

Documents & Links for Anti KBTBD6 pAb (ATL-HPA046861)
Datasheet Anti KBTBD6 pAb (ATL-HPA046861) Datasheet (External Link)
Vendor Page Anti KBTBD6 pAb (ATL-HPA046861)