Anti KBTBD3 pAb (ATL-HPA047385)

Atlas Antibodies

SKU:
ATL-HPA047385-25
  • Immunohistochemical staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: kelch repeat and BTB (POZ) domain containing 3
Gene Name: KBTBD3
Alternative Gene Name: BKLHD3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025893: 94%, ENSRNOG00000022252: 94%
Entrez Gene ID: 143879
Uniprot ID: Q8NAB2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IMDAIKCVQGSGGLFPDARPSTTEKYIFIHKTEENGENQYTFCYNIKSDSWKILPQSHLIDLPGSSLSSYGEKIFLTGGCKGKCCRTVRLHIAESYHDATDQTWCY
Gene Sequence IMDAIKCVQGSGGLFPDARPSTTEKYIFIHKTEENGENQYTFCYNIKSDSWKILPQSHLIDLPGSSLSSYGEKIFLTGGCKGKCCRTVRLHIAESYHDATDQTWCY
Gene ID - Mouse ENSMUSG00000025893
Gene ID - Rat ENSRNOG00000022252
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti KBTBD3 pAb (ATL-HPA047385)
Datasheet Anti KBTBD3 pAb (ATL-HPA047385) Datasheet (External Link)
Vendor Page Anti KBTBD3 pAb (ATL-HPA047385) at Atlas Antibodies

Documents & Links for Anti KBTBD3 pAb (ATL-HPA047385)
Datasheet Anti KBTBD3 pAb (ATL-HPA047385) Datasheet (External Link)
Vendor Page Anti KBTBD3 pAb (ATL-HPA047385)