Anti KAT2B pAb (ATL-HPA055839)

Atlas Antibodies

SKU: ATL-HPA055839-25

• 

Protein Description: K(lysine) acetyltransferase 2B
Gene Name: KAT2B
Alternative Gene Name: GCN5, GCN5L, P/CAF, PCAF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000708: 94%, ENSRNOG00000018364: 59%
Entrez Gene ID: 8850
Uniprot ID: Q92831
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KFSHLPAKERQTIVELAKMFLNRINYWHLEAPSQRRLRSPNDDISGYKENY
• Gene Sequence: KFSHLPAKERQTIVELAKMFLNRINYWHLEAPSQRRLRSPNDDISGYKENY
• Gene ID - Mouse: ENSMUSG00000000708
• Gene ID - Rat: ENSRNOG00000018364
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.