Anti KANSL1L pAb (ATL-HPA046790)

Atlas Antibodies

SKU: ATL-HPA046790-100

• 
• 

Protein Description: KAT8 regulatory NSL complex subunit 1-like
Gene Name: KANSL1L
Alternative Gene Name: C2orf67, FLJ23861, FLJ32349, KIAA1267L, MSL1v2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026004: 83%, ENSRNOG00000028149: 81%
Entrez Gene ID: 151050
Uniprot ID: A0AUZ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MLYMESPRTVDEKLKGDTFSQMLGFPTPEPTLNTNFVNLKHFGSPQSSKHYQTVFLMRSNSTLNKHNENYKQKKLGEPSCNKLKNILYNGSNIQLSKICLSH
• Gene Sequence: MLYMESPRTVDEKLKGDTFSQMLGFPTPEPTLNTNFVNLKHFGSPQSSKHYQTVFLMRSNSTLNKHNENYKQKKLGEPSCNKLKNILYNGSNIQLSKICLSH
• Gene ID - Mouse: ENSMUSG00000026004
• Gene ID - Rat: ENSRNOG00000028149
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.