Anti KANK3 pAb (ATL-HPA051153 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA051153-25

• 
• 
• 

Protein Description: KN motif and ankyrin repeat domains 3
Gene Name: KANK3
Alternative Gene Name: ANKRD47, FLJ46061
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042099: 45%, ENSRNOG00000007230: 51%
Entrez Gene ID: 256949
Uniprot ID: Q6NY19
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QLREATTQTPWSCAEKAAQTESPAEAPSLTQESSPGSMDGDRAVAPAGILKSIMK
• Gene Sequence: QLREATTQTPWSCAEKAAQTESPAEAPSLTQESSPGSMDGDRAVAPAGILKSIMK
• Gene ID - Mouse: ENSMUSG00000042099
• Gene ID - Rat: ENSRNOG00000007230
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.