Anti JRKL pAb (ATL-HPA060341)
Atlas Antibodies
- SKU:
- ATL-HPA060341-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: JRKL
Alternative Gene Name: HHMJG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079083: 98%, ENSRNOG00000047133: 93%
Entrez Gene ID: 8690
Uniprot ID: Q9Y4A0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RFKQRHSIREINIRNERLNGDETAVEDFCNNFRDFIERENLQPE |
Gene Sequence | RFKQRHSIREINIRNERLNGDETAVEDFCNNFRDFIERENLQPE |
Gene ID - Mouse | ENSMUSG00000079083 |
Gene ID - Rat | ENSRNOG00000047133 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti JRKL pAb (ATL-HPA060341) | |
Datasheet | Anti JRKL pAb (ATL-HPA060341) Datasheet (External Link) |
Vendor Page | Anti JRKL pAb (ATL-HPA060341) at Atlas Antibodies |
Documents & Links for Anti JRKL pAb (ATL-HPA060341) | |
Datasheet | Anti JRKL pAb (ATL-HPA060341) Datasheet (External Link) |
Vendor Page | Anti JRKL pAb (ATL-HPA060341) |