Anti JMJD1C pAb (ATL-HPA066195)

Atlas Antibodies

SKU:
ATL-HPA066195-25
  • Immunofluorescent staining of human cell line RH-30 shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: jumonji domain containing 1C
Gene Name: JMJD1C
Alternative Gene Name: DKFZp761F0118, FLJ14374, KIAA1380, TRIP8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037876: 86%, ENSRNOG00000000648: 82%
Entrez Gene ID: 221037
Uniprot ID: Q15652
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IIPGSVLTDLLDAMHTLREKYGIKSHCHCTNKQNLQVGNFPTMNGVSQVLQNVLNHSNKISLCMPESQQQNTPPKS
Gene Sequence IIPGSVLTDLLDAMHTLREKYGIKSHCHCTNKQNLQVGNFPTMNGVSQVLQNVLNHSNKISLCMPESQQQNTPPKS
Gene ID - Mouse ENSMUSG00000037876
Gene ID - Rat ENSRNOG00000000648
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti JMJD1C pAb (ATL-HPA066195)
Datasheet Anti JMJD1C pAb (ATL-HPA066195) Datasheet (External Link)
Vendor Page Anti JMJD1C pAb (ATL-HPA066195) at Atlas Antibodies

Documents & Links for Anti JMJD1C pAb (ATL-HPA066195)
Datasheet Anti JMJD1C pAb (ATL-HPA066195) Datasheet (External Link)
Vendor Page Anti JMJD1C pAb (ATL-HPA066195)