Protein Description: jumonji domain containing 1C
Gene Name: JMJD1C
Alternative Gene Name: DKFZp761F0118, FLJ14374, KIAA1380, TRIP8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037876: 86%, ENSRNOG00000000648: 82%
Entrez Gene ID: 221037
Uniprot ID: Q15652
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: JMJD1C
Alternative Gene Name: DKFZp761F0118, FLJ14374, KIAA1380, TRIP8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037876: 86%, ENSRNOG00000000648: 82%
Entrez Gene ID: 221037
Uniprot ID: Q15652
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | IIPGSVLTDLLDAMHTLREKYGIKSHCHCTNKQNLQVGNFPTMNGVSQVLQNVLNHSNKISLCMPESQQQNTPPKS |
| Documents & Links for Anti JMJD1C pAb (ATL-HPA066195) | |
| Datasheet | Anti JMJD1C pAb (ATL-HPA066195) Datasheet (External Link) |
| Vendor Page | Anti JMJD1C pAb (ATL-HPA066195) at Atlas |
| Documents & Links for Anti JMJD1C pAb (ATL-HPA066195) | |
| Datasheet | Anti JMJD1C pAb (ATL-HPA066195) Datasheet (External Link) |
| Vendor Page | Anti JMJD1C pAb (ATL-HPA066195) |