Anti JAML pAb (ATL-HPA047919)

Atlas Antibodies

SKU: ATL-HPA047919-25

• 
• 

Protein Description: junction adhesion molecule like
Gene Name: JAML
Alternative Gene Name: AMICA, AMICA1, Gm638
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048534: 42%, ENSRNOG00000026702: 42%
Entrez Gene ID: 120425
Uniprot ID: Q86YT9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KKTCGNKSSVNSTVLVKNTKKTNPEIKEKPCHFERCEGEKHIYSPIIVREVIEEEEPSEKSEATYMTMHPVWPSLRSDRNNSL
• Gene Sequence: KKTCGNKSSVNSTVLVKNTKKTNPEIKEKPCHFERCEGEKHIYSPIIVREVIEEEEPSEKSEATYMTMHPVWPSLRSDRNNSL
• Gene ID - Mouse: ENSMUSG00000048534
• Gene ID - Rat: ENSRNOG00000026702
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.