Anti JAM3 pAb (ATL-HPA050434)

Atlas Antibodies

SKU:
ATL-HPA050434-100
  • Immunofluorescent staining of human cell line RH-30 shows localization to the Golgi apparatus.
  • Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: junctional adhesion molecule 3
Gene Name: JAM3
Alternative Gene Name: JAM-C, JAMC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031990: 81%, ENSRNOG00000009149: 81%
Entrez Gene ID: 83700
Uniprot ID: Q9BX67
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SATLDMALRRPPRLRLCARLPDFFLLLLFRGCLIGAVNLKSSNRTPVVQEFESVELSCIITDSQTSDPRIEWKKIQDEQTTYVFFDNKIQGDLAGRAEILGKTSLKI
Gene Sequence SATLDMALRRPPRLRLCARLPDFFLLLLFRGCLIGAVNLKSSNRTPVVQEFESVELSCIITDSQTSDPRIEWKKIQDEQTTYVFFDNKIQGDLAGRAEILGKTSLKI
Gene ID - Mouse ENSMUSG00000031990
Gene ID - Rat ENSRNOG00000009149
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti JAM3 pAb (ATL-HPA050434)
Datasheet Anti JAM3 pAb (ATL-HPA050434) Datasheet (External Link)
Vendor Page Anti JAM3 pAb (ATL-HPA050434) at Atlas Antibodies

Documents & Links for Anti JAM3 pAb (ATL-HPA050434)
Datasheet Anti JAM3 pAb (ATL-HPA050434) Datasheet (External Link)
Vendor Page Anti JAM3 pAb (ATL-HPA050434)