Anti JADE1 pAb (ATL-HPA020016)

Atlas Antibodies

SKU:
ATL-HPA020016-25
  • Immunohistochemical staining of human liver shows strong granular positivity in hepatocytes.
  • Western blot analysis in human cell line SCLC-21H.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: jade family PHD finger 1
Gene Name: JADE1
Alternative Gene Name: JADE-1, PHF17
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025764: 84%, ENSRNOG00000014066: 86%
Entrez Gene ID: 79960
Uniprot ID: Q6IE81
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen VCKVQEQIFNLYTKLLEQERVSGVPSSCSSSSLENMLLFNSPSVGPDAPKIEDLKWHSAFFRKQMGTSLVHSLKKPHKRDPLQNSPGSEGKTLLKQPDL
Gene Sequence VCKVQEQIFNLYTKLLEQERVSGVPSSCSSSSLENMLLFNSPSVGPDAPKIEDLKWHSAFFRKQMGTSLVHSLKKPHKRDPLQNSPGSEGKTLLKQPDL
Gene ID - Mouse ENSMUSG00000025764
Gene ID - Rat ENSRNOG00000014066
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti JADE1 pAb (ATL-HPA020016)
Datasheet Anti JADE1 pAb (ATL-HPA020016) Datasheet (External Link)
Vendor Page Anti JADE1 pAb (ATL-HPA020016) at Atlas Antibodies

Documents & Links for Anti JADE1 pAb (ATL-HPA020016)
Datasheet Anti JADE1 pAb (ATL-HPA020016) Datasheet (External Link)
Vendor Page Anti JADE1 pAb (ATL-HPA020016)