Anti IVL pAb (ATL-HPA055211 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA055211-25

• 
• 

Protein Description: involucrin
Gene Name: IVL
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049128: 52%, ENSRNOG00000009314: 53%
Entrez Gene ID: 3713
Uniprot ID: P07476
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QQHTLPVTLSPALSQELLKTVPPPVNTHQEQMKQPTPLPPPCQKVPVELPVEVPSKQEEKHMTAVKGLPEQECEQ
• Gene Sequence: QQHTLPVTLSPALSQELLKTVPPPVNTHQEQMKQPTPLPPPCQKVPVELPVEVPSKQEEKHMTAVKGLPEQECEQ
• Gene ID - Mouse: ENSMUSG00000049128
• Gene ID - Rat: ENSRNOG00000009314
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti IVL pAb (ATL-HPA055211 w/enhanced validation) – 4 Found

Hong, Yue; Shan, Shan; Gu, Ye; Huang, Haidong; Zhang, Quncheng; Han, Yang; Dong, Yongpin; Liu, Zeyu; Huang, Moli; Ren, Tao. Malfunction of airway basal stem cells plays a crucial role in pathophysiology of tracheobronchopathia osteoplastica. Nature Communications. 2022;13(1):1309. 

Okazaki, Shogo; Umene, Kiyoko; Yamasaki, Juntaro; Suina, Kentaro; Otsuki, Yuji; Yoshikawa, Momoko; Minami, Yushi; Masuko, Takashi; Kawaguchi, Sho; Nakayama, Hideki; Banno, Kouji; Aoki, Daisuke; Saya, Hideyuki; Nagano, Osamu. Glutaminolysis-related genes determine sensitivity to xCT-targeted therapy in head and neck squamous cell carcinoma. Cancer Science. 2019;110(11):3453-3463. 

Joly-Tonetti, Nicolas; Ondet, Thomas; Monshouwer, Mario; Stamatas, Georgios N. EGFR inhibitors switch keratinocytes from a proliferative to a differentiative phenotype affecting epidermal development and barrier function. Bmc Cancer. 2021;21(1):5. 

Rao, Wei; Wang, Shan; Duleba, Marcin; Niroula, Suchan; Goller, Kristina; Xie, Jingzhong; Mahalingam, Rajasekaran; Neupane, Rahul; Liew, Audrey-Ann; Vincent, Matthew; Okuda, Kenichi; O'Neal, Wanda K; Boucher, Richard C; Dickey, Burton F; Wechsler, Michael E; Ibrahim, Omar; Engelhardt, John F; Mertens, Tinne C J; Wang, Wei; Jyothula, Soma S K; Crum, Christopher P; Karmouty-Quintana, Harry; Parekh, Kalpaj R; Metersky, Mark L; McKeon, Frank D; Xian, Wa. Regenerative Metaplastic Clones in COPD Lung Drive Inflammation and Fibrosis. Cell. 2020;181(4):848-864.e18.