Anti ITPKC pAb (ATL-HPA053003)

Atlas Antibodies

SKU:
ATL-HPA053003-25
  • Immunohistochemical staining of human testis shows strong nuclear and cytoplasmic positivity in cells in seminiferus ducts.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: inositol-trisphosphate 3-kinase C
Gene Name: ITPKC
Alternative Gene Name: IP3-3KC, IP3KC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003752: 66%, ENSRNOG00000013945: 62%
Entrez Gene ID: 80271
Uniprot ID: Q96DU7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QIQQDTDGSWTQPSTDGSQTAPGTDCLLGEPEDGPLEEPEPGELLTHLYSHLKCSPLCPVPRLIITPETPEPEAQPVGPPSRVEGGSGGFSSASSFDESE
Gene Sequence QIQQDTDGSWTQPSTDGSQTAPGTDCLLGEPEDGPLEEPEPGELLTHLYSHLKCSPLCPVPRLIITPETPEPEAQPVGPPSRVEGGSGGFSSASSFDESE
Gene ID - Mouse ENSMUSG00000003752
Gene ID - Rat ENSRNOG00000013945
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ITPKC pAb (ATL-HPA053003)
Datasheet Anti ITPKC pAb (ATL-HPA053003) Datasheet (External Link)
Vendor Page Anti ITPKC pAb (ATL-HPA053003) at Atlas Antibodies

Documents & Links for Anti ITPKC pAb (ATL-HPA053003)
Datasheet Anti ITPKC pAb (ATL-HPA053003) Datasheet (External Link)
Vendor Page Anti ITPKC pAb (ATL-HPA053003)