Anti ITPK1 pAb (ATL-HPA055230)

Atlas Antibodies

SKU: ATL-HPA055230-25

• 
• 
• 

Protein Description: inositol-tetrakisphosphate 1-kinase
Gene Name: ITPK1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057963: 76%, ENSRNOG00000008051: 76%
Entrez Gene ID: 3705
Uniprot ID: Q13572
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FTDLLNHIATVLQGQSTAMAATGDVALLRHSKLLAEPAGGLVGERTCSASPGCCGSMMGQDAPWKAEADAGGTAKLPHQRLGC
• Gene Sequence: FTDLLNHIATVLQGQSTAMAATGDVALLRHSKLLAEPAGGLVGERTCSASPGCCGSMMGQDAPWKAEADAGGTAKLPHQRLGC
• Gene ID - Mouse: ENSMUSG00000057963
• Gene ID - Rat: ENSRNOG00000008051
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ITPK1 pAb (ATL-HPA055230) – 1 Found

Douanne, Tiphaine; André-Grégoire, Gwennan; Trillet, Kilian; Thys, An; Papin, Antonin; Feyeux, Magalie; Hulin, Philippe; Chiron, David; Gavard, Julie; Bidère, Nicolas. Pannexin-1 limits the production of proinflammatory cytokines during necroptosis. Embo Reports. 2019;20(10):e47840.