Anti ITCH pAb (ATL-HPA049032 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA049032-25

• 
• 

Protein Description: itchy E3 ubiquitin protein ligase
Gene Name: ITCH
Alternative Gene Name: AIP4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027598: 78%, ENSRNOG00000059043: 82%
Entrez Gene ID: 83737
Uniprot ID: Q96J02
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GFTGASQNDDGSRSKDETRVSTNGSDDPEDAGAGENRRVSGNNSPSLSNGGFKPSRPPRPSRPPPPTPRRPASVNGS
• Gene Sequence: GFTGASQNDDGSRSKDETRVSTNGSDDPEDAGAGENRRVSGNNSPSLSNGGFKPSRPPRPSRPPPPTPRRPASVNGS
• Gene ID - Mouse: ENSMUSG00000027598
• Gene ID - Rat: ENSRNOG00000059043
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.