Anti IST1 pAb (ATL-HPA054532 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA054532-25

• 
• 
• 

Protein Description: increased sodium tolerance 1 homolog (yeast)
Gene Name: IST1
Alternative Gene Name: KIAA0174
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031729: 100%, ENSRNOG00000015144: 100%
Entrez Gene ID: 9798
Uniprot ID: P53990
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LGSGFKAERLRVNLRLVINRLKLLEKKKTELAQKARKEIADYLAAGKDERARIRVEHIIREDYLVEAMEILELYCDLL
• Gene Sequence: LGSGFKAERLRVNLRLVINRLKLLEKKKTELAQKARKEIADYLAAGKDERARIRVEHIIREDYLVEAMEILELYCDLL
• Gene ID - Mouse: ENSMUSG00000031729
• Gene ID - Rat: ENSRNOG00000015144
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.