Anti IRS1 pAb (ATL-HPA046433)
Atlas Antibodies
- SKU:
- ATL-HPA046433-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: IRS1
Alternative Gene Name: HIRS-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055980: 93%, ENSRNOG00000014597: 92%
Entrez Gene ID: 3667
Uniprot ID: P35568
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RKRTHSAGTSPTITHQKTPSQSSVASIEEYTEMMPAYPPGGGSGGRLPGHRHSAFVPTRSYPEEGLEMHPL |
Gene Sequence | RKRTHSAGTSPTITHQKTPSQSSVASIEEYTEMMPAYPPGGGSGGRLPGHRHSAFVPTRSYPEEGLEMHPL |
Gene ID - Mouse | ENSMUSG00000055980 |
Gene ID - Rat | ENSRNOG00000014597 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti IRS1 pAb (ATL-HPA046433) | |
Datasheet | Anti IRS1 pAb (ATL-HPA046433) Datasheet (External Link) |
Vendor Page | Anti IRS1 pAb (ATL-HPA046433) at Atlas Antibodies |
Documents & Links for Anti IRS1 pAb (ATL-HPA046433) | |
Datasheet | Anti IRS1 pAb (ATL-HPA046433) Datasheet (External Link) |
Vendor Page | Anti IRS1 pAb (ATL-HPA046433) |