Anti IRGC pAb (ATL-HPA060064 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA060064-25

• 

Protein Description: immunity-related GTPase family, cinema
Gene Name: IRGC
Alternative Gene Name: CINEMA, Iigp5, IRGC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062028: 99%, ENSRNOG00000024257: 99%
Entrez Gene ID: 56269
Uniprot ID: Q6NXR0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ALLIHSLRGYHRSFGLDDDSLAKLAEQVGKQAGDLRSVIRSPLANEVSPETVLRLYSQSSDGAMRVARAFERGIPVFGTLVA
• Gene Sequence: ALLIHSLRGYHRSFGLDDDSLAKLAEQVGKQAGDLRSVIRSPLANEVSPETVLRLYSQSSDGAMRVARAFERGIPVFGTLVA
• Gene ID - Mouse: ENSMUSG00000062028
• Gene ID - Rat: ENSRNOG00000024257
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.