Anti IRF5 pAb (ATL-HPA046700)
Atlas Antibodies
- SKU:
- ATL-HPA046700-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: IRF5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029771: 82%, ENSRNOG00000007437: 82%
Entrez Gene ID: 3663
Uniprot ID: Q13568
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NKSRDFRLIYDGPRDMPPQPYKIYEVCSNGPAPTDSQPPEDYSFGAGEEEE |
Gene Sequence | NKSRDFRLIYDGPRDMPPQPYKIYEVCSNGPAPTDSQPPEDYSFGAGEEEE |
Gene ID - Mouse | ENSMUSG00000029771 |
Gene ID - Rat | ENSRNOG00000007437 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti IRF5 pAb (ATL-HPA046700) | |
Datasheet | Anti IRF5 pAb (ATL-HPA046700) Datasheet (External Link) |
Vendor Page | Anti IRF5 pAb (ATL-HPA046700) at Atlas Antibodies |
Documents & Links for Anti IRF5 pAb (ATL-HPA046700) | |
Datasheet | Anti IRF5 pAb (ATL-HPA046700) Datasheet (External Link) |
Vendor Page | Anti IRF5 pAb (ATL-HPA046700) |
Citations for Anti IRF5 pAb (ATL-HPA046700) – 1 Found |
Idborg, Helena; Zandian, Arash; Ossipova, Elena; Wigren, Edvard; Preger, Charlotta; Mobarrez, Fariborz; Checa, Antonio; Sohrabian, Azita; Pucholt, Pascal; Sandling, Johanna K; Fernandes-Cerqueira, Cátia; Rönnelid, Johan; Oke, Vilija; Grosso, Giorgia; Kvarnström, Marika; Larsson, Anders; Wheelock, Craig E; Syvänen, Ann-Christine; Rönnblom, Lars; Kultima, Kim; Persson, Helena; Gräslund, Susanne; Gunnarsson, Iva; Nilsson, Peter; Svenungsson, Elisabet; Jakobsson, Per-Johan. Circulating Levels of Interferon Regulatory Factor-5 Associates With Subgroups of Systemic Lupus Erythematosus Patients. Frontiers In Immunology. 10( 31156624):1029. PubMed |