Anti IRF2BPL pAb (ATL-HPA061333 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA061333-25

• 
• 

Product Description

Protein Description: interferon regulatory factor 2 binding protein-like
Gene Name: IRF2BPL
Alternative Gene Name: C14orf4, EAP1, KIAA1865
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034168: 98%, ENSRNOG00000011026: 98%
Entrez Gene ID: 64207
Uniprot ID: Q9H1B7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SLRKRKASPEPPDSAEGALKLGEEQQRQQWMANQSEALKLTMSAG
• Gene Sequence: SLRKRKASPEPPDSAEGALKLGEEQQRQQWMANQSEALKLTMSAG
• Gene ID - Mouse: ENSMUSG00000034168
• Gene ID - Rat: ENSRNOG00000011026
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links