Anti IRAK2 pAb (ATL-HPA050520)
Atlas Antibodies
- SKU:
- ATL-HPA050520-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: IRAK2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060477: 61%, ENSRNOG00000021817: 65%
Entrez Gene ID: 3656
Uniprot ID: O43187
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AFLQPPEEDAPHSLRSDLPTSSDSKDFSTSIPKQEKLLSLAGDSLFWSEADVVQATDDFNQNRKISQGTFADVYRGHRHGKPFVFKKL |
Gene Sequence | AFLQPPEEDAPHSLRSDLPTSSDSKDFSTSIPKQEKLLSLAGDSLFWSEADVVQATDDFNQNRKISQGTFADVYRGHRHGKPFVFKKL |
Gene ID - Mouse | ENSMUSG00000060477 |
Gene ID - Rat | ENSRNOG00000021817 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti IRAK2 pAb (ATL-HPA050520) | |
Datasheet | Anti IRAK2 pAb (ATL-HPA050520) Datasheet (External Link) |
Vendor Page | Anti IRAK2 pAb (ATL-HPA050520) at Atlas Antibodies |
Documents & Links for Anti IRAK2 pAb (ATL-HPA050520) | |
Datasheet | Anti IRAK2 pAb (ATL-HPA050520) Datasheet (External Link) |
Vendor Page | Anti IRAK2 pAb (ATL-HPA050520) |