Anti IRAK1 pAb (ATL-HPA054476)

Atlas Antibodies

SKU:
ATL-HPA054476-25
  • Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glands.
  • Immunofluorescent staining of human cell line MCF7 shows localization to nucleus & cytosol.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: interleukin-1 receptor-associated kinase 1
Gene Name: IRAK1
Alternative Gene Name: IRAK, pelle
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031392: 99%, ENSRNOG00000060869: 99%
Entrez Gene ID: 3654
Uniprot ID: P51617
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GAQHFLYEVPPWVMCRFYKVMDALEPADWCQFAALIVRDQTELRLCERSGQRTASVLWPWINRNARVADLVHILTHLQLLRARDIITAWHP
Gene Sequence GAQHFLYEVPPWVMCRFYKVMDALEPADWCQFAALIVRDQTELRLCERSGQRTASVLWPWINRNARVADLVHILTHLQLLRARDIITAWHP
Gene ID - Mouse ENSMUSG00000031392
Gene ID - Rat ENSRNOG00000060869
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti IRAK1 pAb (ATL-HPA054476)
Datasheet Anti IRAK1 pAb (ATL-HPA054476) Datasheet (External Link)
Vendor Page Anti IRAK1 pAb (ATL-HPA054476) at Atlas Antibodies

Documents & Links for Anti IRAK1 pAb (ATL-HPA054476)
Datasheet Anti IRAK1 pAb (ATL-HPA054476) Datasheet (External Link)
Vendor Page Anti IRAK1 pAb (ATL-HPA054476)