Protein Description: intracisternal A particle-promoted polypeptide
Gene Name: IPP
Alternative Gene Name: KLHL27
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028696: 96%, ENSRNOG00000016183: 96%
Entrez Gene ID: 3652
Uniprot ID: Q9Y573
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: IPP
Alternative Gene Name: KLHL27
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028696: 96%, ENSRNOG00000016183: 96%
Entrez Gene ID: 3652
Uniprot ID: Q9Y573
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SGLGVTVLGGMVYAIGGEKDSMIFDCTECYDPVTKQWTTVASMNHPRCGLGVCVCYGAIYALGGWVGAEIGNTIERFDPD |
| Documents & Links for Anti IPP pAb (ATL-HPA075545) | |
| Datasheet | Anti IPP pAb (ATL-HPA075545) Datasheet (External Link) |
| Vendor Page | Anti IPP pAb (ATL-HPA075545) at Atlas |
| Documents & Links for Anti IPP pAb (ATL-HPA075545) | |
| Datasheet | Anti IPP pAb (ATL-HPA075545) Datasheet (External Link) |
| Vendor Page | Anti IPP pAb (ATL-HPA075545) |