Protein Description: importin 11
Gene Name: IPO11
Alternative Gene Name: RanBP11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042590: 94%, ENSRNOG00000039717: 77%
Entrez Gene ID: 51194
Uniprot ID: Q9UI26
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: IPO11
Alternative Gene Name: RanBP11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042590: 94%, ENSRNOG00000039717: 77%
Entrez Gene ID: 51194
Uniprot ID: Q9UI26
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | QLLGNMIEMWVDRMDNITQPERRKLSALALLSLLPSDNSVIQDKFCGIINISVEGLHDVMTEDPETGTYKDCMLMSHLEEPKVTEDEEPPTEQD |
| Documents & Links for Anti IPO11 pAb (ATL-HPA067097 w/enhanced validation) | |
| Datasheet | Anti IPO11 pAb (ATL-HPA067097 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti IPO11 pAb (ATL-HPA067097 w/enhanced validation) at Atlas |
| Documents & Links for Anti IPO11 pAb (ATL-HPA067097 w/enhanced validation) | |
| Datasheet | Anti IPO11 pAb (ATL-HPA067097 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti IPO11 pAb (ATL-HPA067097 w/enhanced validation) |