Protein Description: importin 11
Gene Name: IPO11
Alternative Gene Name: RanBP11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042590: 100%, ENSRNOG00000039717: 100%
Entrez Gene ID: 51194
Uniprot ID: Q9UI26
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: IPO11
Alternative Gene Name: RanBP11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042590: 100%, ENSRNOG00000039717: 100%
Entrez Gene ID: 51194
Uniprot ID: Q9UI26
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | AHKIKMAFFTYPTLTEICRRLVSHYFLLTEEELTMWEEDPEGFTVEETGGDSWKYSLRPCTEVLFIDIFHEYNQ |
Documents & Links for Anti IPO11 pAb (ATL-HPA065346) | |
Datasheet | Anti IPO11 pAb (ATL-HPA065346) Datasheet (External Link) |
Vendor Page | Anti IPO11 pAb (ATL-HPA065346) at Atlas |
Documents & Links for Anti IPO11 pAb (ATL-HPA065346) | |
Datasheet | Anti IPO11 pAb (ATL-HPA065346) Datasheet (External Link) |
Vendor Page | Anti IPO11 pAb (ATL-HPA065346) |