Protein Description: inositol hexakisphosphate kinase 2
Gene Name: IP6K2
Alternative Gene Name: IHPK2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000106672: 94%, ENSRNOG00000020361: 96%
Entrez Gene ID: 51447
Uniprot ID: Q9UHH9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: IP6K2
Alternative Gene Name: IHPK2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000106672: 94%, ENSRNOG00000020361: 96%
Entrez Gene ID: 51447
Uniprot ID: Q9UHH9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | RFEEDEDRNLCLIAYPLKGDHGIVDIVDNSDCEPKSKLLRWTTNKKHHVLETEKTPKDWVRQHRKEEK |
| Documents & Links for Anti IP6K2 pAb (ATL-HPA070811) | |
| Datasheet | Anti IP6K2 pAb (ATL-HPA070811) Datasheet (External Link) |
| Vendor Page | Anti IP6K2 pAb (ATL-HPA070811) at Atlas |
| Documents & Links for Anti IP6K2 pAb (ATL-HPA070811) | |
| Datasheet | Anti IP6K2 pAb (ATL-HPA070811) Datasheet (External Link) |
| Vendor Page | Anti IP6K2 pAb (ATL-HPA070811) |