Anti INTS9 pAb (ATL-HPA051615)
Atlas Antibodies
- SKU:
- ATL-HPA051615-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: INTS9
Alternative Gene Name: CPSF2L, FLJ10871, RC-74
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021975: 97%, ENSRNOG00000013459: 97%
Entrez Gene ID: 55756
Uniprot ID: Q9NV88
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FAEWLCHNKQSKVYLPEPPFPHAELIQTNKLKHYPSIHGDFSNDFRQPCVVFTGHPSLRFGDVVHFMELWGKSSLNTVIFTEPDFSYLEALAP |
| Gene Sequence | FAEWLCHNKQSKVYLPEPPFPHAELIQTNKLKHYPSIHGDFSNDFRQPCVVFTGHPSLRFGDVVHFMELWGKSSLNTVIFTEPDFSYLEALAP |
| Gene ID - Mouse | ENSMUSG00000021975 |
| Gene ID - Rat | ENSRNOG00000013459 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti INTS9 pAb (ATL-HPA051615) | |
| Datasheet | Anti INTS9 pAb (ATL-HPA051615) Datasheet (External Link) |
| Vendor Page | Anti INTS9 pAb (ATL-HPA051615) at Atlas Antibodies |
| Documents & Links for Anti INTS9 pAb (ATL-HPA051615) | |
| Datasheet | Anti INTS9 pAb (ATL-HPA051615) Datasheet (External Link) |
| Vendor Page | Anti INTS9 pAb (ATL-HPA051615) |
| Citations for Anti INTS9 pAb (ATL-HPA051615) – 1 Found |
| Tilley, F C; Arrondel, C; Chhuon, C; Boisson, M; Cagnard, N; Parisot, M; Menara, G; Lefort, N; Guerrera, I C; Bole-Feysot, C; Benmerah, A; Antignac, C; Mollet, G. Disruption of pathways regulated by Integrator complex in Galloway-Mowat syndrome due to WDR73 mutations. Scientific Reports. 2021;11(1):5388. PubMed |