Anti INTS2 pAb (ATL-HPA049524)

Atlas Antibodies

SKU:
ATL-HPA049524-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: integrator complex subunit 2
Gene Name: INTS2
Alternative Gene Name: INT2, KIAA1287
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018068: 84%, ENSRNOG00000003576: 83%
Entrez Gene ID: 57508
Uniprot ID: Q9H0H0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ICLPTEEEKANGVNPDSLLRNVQSVITTSAPNKGMEEGEDNLLCNLREVQCLICCLLHQMYIADPNIAKLVHFQGYPCELL
Gene Sequence ICLPTEEEKANGVNPDSLLRNVQSVITTSAPNKGMEEGEDNLLCNLREVQCLICCLLHQMYIADPNIAKLVHFQGYPCELL
Gene ID - Mouse ENSMUSG00000018068
Gene ID - Rat ENSRNOG00000003576
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti INTS2 pAb (ATL-HPA049524)
Datasheet Anti INTS2 pAb (ATL-HPA049524) Datasheet (External Link)
Vendor Page Anti INTS2 pAb (ATL-HPA049524) at Atlas Antibodies

Documents & Links for Anti INTS2 pAb (ATL-HPA049524)
Datasheet Anti INTS2 pAb (ATL-HPA049524) Datasheet (External Link)
Vendor Page Anti INTS2 pAb (ATL-HPA049524)