![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/101040/181078/atl-hpa073020_anti-ints13-pab-atl-hpa073020_62746__27814.1681137321.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG")
Protein Description: integrator complex subunit 13
Gene Name: INTS13
Alternative Gene Name: ASUN, C12orf11, FLJ10637, Mat89Bb, NET48, SPATA30
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040250: 95%, ENSRNOG00000001808: 96%
Entrez Gene ID: 55726
Uniprot ID: Q9NVM9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: INTS13
Alternative Gene Name: ASUN, C12orf11, FLJ10637, Mat89Bb, NET48, SPATA30
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040250: 95%, ENSRNOG00000001808: 96%
Entrez Gene ID: 55726
Uniprot ID: Q9NVM9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | RGKEELAEAEIIKDSPDSPEPPNKKPLVEMDETPQVEKSKGPVSLLSLWSNRINTANSRKHQEFAGRLNSVNN |
| Documents & Links for Anti INTS13 pAb (ATL-HPA073020) | |
| Datasheet | Anti INTS13 pAb (ATL-HPA073020) Datasheet (External Link) |
| Vendor Page | Anti INTS13 pAb (ATL-HPA073020) at Atlas |
| Documents & Links for Anti INTS13 pAb (ATL-HPA073020) | |
| Datasheet | Anti INTS13 pAb (ATL-HPA073020) Datasheet (External Link) |
| Vendor Page | Anti INTS13 pAb (ATL-HPA073020) |