Anti INTS13 pAb (ATL-HPA073020)

Atlas Antibodies

SKU: ATL-HPA073020-100

• 
• 

Protein Description: integrator complex subunit 13
Gene Name: INTS13
Alternative Gene Name: ASUN, C12orf11, FLJ10637, Mat89Bb, NET48, SPATA30
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040250: 95%, ENSRNOG00000001808: 96%
Entrez Gene ID: 55726
Uniprot ID: Q9NVM9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RGKEELAEAEIIKDSPDSPEPPNKKPLVEMDETPQVEKSKGPVSLLSLWSNRINTANSRKHQEFAGRLNSVNN
• Gene Sequence: RGKEELAEAEIIKDSPDSPEPPNKKPLVEMDETPQVEKSKGPVSLLSLWSNRINTANSRKHQEFAGRLNSVNN
• Gene ID - Mouse: ENSMUSG00000040250
• Gene ID - Rat: ENSRNOG00000001808
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.