Anti INTS10 pAb (ATL-HPA050570)

Atlas Antibodies

SKU:
ATL-HPA050570-25
  • Immunohistochemical staining of human heart muscle shows strong cytoplasmic positivity in myocytes.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: integrator complex subunit 10
Gene Name: INTS10
Alternative Gene Name: C8orf35, FLJ10569, INT10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031864: 96%, ENSRNOG00000055331: 97%
Entrez Gene ID: 55174
Uniprot ID: Q9NVR2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RGENLFLKAVNKICQQGNFQYENFFNYVTNIDMLEEFAYLRTQEGGKIHLELLPNQGMLIKHHTVTRGITKGVKEDFRLAMERQVSRCGENLMVVLHRFC
Gene Sequence RGENLFLKAVNKICQQGNFQYENFFNYVTNIDMLEEFAYLRTQEGGKIHLELLPNQGMLIKHHTVTRGITKGVKEDFRLAMERQVSRCGENLMVVLHRFC
Gene ID - Mouse ENSMUSG00000031864
Gene ID - Rat ENSRNOG00000055331
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti INTS10 pAb (ATL-HPA050570)
Datasheet Anti INTS10 pAb (ATL-HPA050570) Datasheet (External Link)
Vendor Page Anti INTS10 pAb (ATL-HPA050570) at Atlas Antibodies

Documents & Links for Anti INTS10 pAb (ATL-HPA050570)
Datasheet Anti INTS10 pAb (ATL-HPA050570) Datasheet (External Link)
Vendor Page Anti INTS10 pAb (ATL-HPA050570)