Protein Description: inhibitor of growth family, member 3
Gene Name: ING3
Alternative Gene Name: Eaf4, FLJ20089, MEAF4, p47ING3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029670: 100%, ENSRNOG00000005496: 100%
Entrez Gene ID: 54556
Uniprot ID: Q9NXR8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ING3
Alternative Gene Name: Eaf4, FLJ20089, MEAF4, p47ING3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029670: 100%, ENSRNOG00000005496: 100%
Entrez Gene ID: 54556
Uniprot ID: Q9NXR8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MLYLEDYLEMIEQLPMDLRDRFTEMREMDLQVQNAMDQLEQRVSEFFMNAKKNKPEWREEQMASIKKDYYKALEDADEKVQLANQI |
| Documents & Links for Anti ING3 pAb (ATL-HPA067575) | |
| Datasheet | Anti ING3 pAb (ATL-HPA067575) Datasheet (External Link) |
| Vendor Page | Anti ING3 pAb (ATL-HPA067575) at Atlas |
| Documents & Links for Anti ING3 pAb (ATL-HPA067575) | |
| Datasheet | Anti ING3 pAb (ATL-HPA067575) Datasheet (External Link) |
| Vendor Page | Anti ING3 pAb (ATL-HPA067575) |
| Citations for Anti ING3 pAb (ATL-HPA067575) – 1 Found |
| Song, Yanhua; Hou, Gaopeng; Diep, Jonathan; Ooi, Yaw Shin; Akopyants, Natalia S; Beverley, Stephen M; Carette, Jan E; Greenberg, Harry B; Ding, Siyuan. Inhibitor of growth protein 3 epigenetically silences endogenous retroviral elements and prevents innate immune activation. Nucleic Acids Research. 2021;49(22):12706-12715. PubMed |