Anti ING1 pAb (ATL-HPA052591)

Atlas Antibodies

SKU: ATL-HPA052591-25

• 

Protein Description: inhibitor of growth family, member 1
Gene Name: ING1
Alternative Gene Name: p24ING1c, p33, p33ING1, p33ING1b, p47, p47ING1a
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045969: 78%, ENSRNOG00000014520: 77%
Entrez Gene ID: 3621
Uniprot ID: Q9UK53
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VELFEAQQELGDTAGNSGKAGADRPKGEAAAQADKPNSKRSRRQRNNENRENASSNHDHDDGASGTPKEKKAKTSKKK
• Gene Sequence: VELFEAQQELGDTAGNSGKAGADRPKGEAAAQADKPNSKRSRRQRNNENRENASSNHDHDDGASGTPKEKKAKTSKKK
• Gene ID - Mouse: ENSMUSG00000045969
• Gene ID - Rat: ENSRNOG00000014520
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.