Anti INF2 pAb (ATL-HPA000724)

Atlas Antibodies

Catalog No.:
ATL-HPA000724-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: inverted formin, FH2 and WH2 domain containing
Gene Name: INF2
Alternative Gene Name: C14orf151, C14orf173, MGC13251
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037679: 90%, ENSRNOG00000028650: 90%
Entrez Gene ID: 64423
Uniprot ID: Q27J81
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GVARISDALLQLTCVSCVRAVMNSRQGIEYILSNQGYVRQLSQALDTSNVMVKKQVFELLAALCIYSPEGHVLTLDALDHYKTVCSQQYRFSIVMNELSGSDNVPYVVTLLSVINAVILGPEDLRARTQLRNEFIGLQLLDVLAR
Gene Sequence GVARISDALLQLTCVSCVRAVMNSRQGIEYILSNQGYVRQLSQALDTSNVMVKKQVFELLAALCIYSPEGHVLTLDALDHYKTVCSQQYRFSIVMNELSGSDNVPYVVTLLSVINAVILGPEDLRARTQLRNEFIGLQLLDVLAR
Gene ID - Mouse ENSMUSG00000037679
Gene ID - Rat ENSRNOG00000028650
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti INF2 pAb (ATL-HPA000724)
Datasheet Anti INF2 pAb (ATL-HPA000724) Datasheet (External Link)
Vendor Page Anti INF2 pAb (ATL-HPA000724) at Atlas Antibodies

Documents & Links for Anti INF2 pAb (ATL-HPA000724)
Datasheet Anti INF2 pAb (ATL-HPA000724) Datasheet (External Link)
Vendor Page Anti INF2 pAb (ATL-HPA000724)
Citations for Anti INF2 pAb (ATL-HPA000724) – 2 Found
Lamm, Katherine Young Bezold; Johnson, Maddison L; Baker Phillips, Julie; Muntifering, Michael B; James, Jeanne M; Jones, Helen N; Redline, Raymond W; Rokas, Antonis; Muglia, Louis J. Inverted formin 2 regulates intracellular trafficking, placentation, and pregnancy outcome. Elife. 2018;7( 29309034)  PubMed
Sun, Hua; Al-Romaih, Khaldoun I; MacRae, Calum A; Pollak, Martin R. Human Kidney Disease-causing INF2 Mutations Perturb Rho/Dia Signaling in the Glomerulus. Ebiomedicine. 2014;1(2-3):107-15.  PubMed