Anti INCA1 pAb (ATL-HPA052401)

Atlas Antibodies

SKU: ATL-HPA052401-25

• 

Protein Description: inhibitor of CDK, cyclin A1 interacting protein 1
Gene Name: INCA1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057054: 56%, ENSRNOG00000037418: 61%
Entrez Gene ID: 388324
Uniprot ID: Q0VD86
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LEEERATYPQEEDRFLTPGRAQLLWSPWSPLDQEEACASRQLHSLASFSTVTARRNPLHNPWGMELAASE
• Gene Sequence: LEEERATYPQEEDRFLTPGRAQLLWSPWSPLDQEEACASRQLHSLASFSTVTARRNPLHNPWGMELAASE
• Gene ID - Mouse: ENSMUSG00000057054
• Gene ID - Rat: ENSRNOG00000037418
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.