Protein Description: IMP3, U3 small nucleolar ribonucleoprotein
Gene Name: IMP3
Alternative Gene Name: BRMS2, C15orf12, FLJ10968, MRPS4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032288: 96%, ENSRNOG00000017460: 96%
Entrez Gene ID: 55272
Uniprot ID: Q9NV31
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: IMP3
Alternative Gene Name: BRMS2, C15orf12, FLJ10968, MRPS4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032288: 96%, ENSRNOG00000017460: 96%
Entrez Gene ID: 55272
Uniprot ID: Q9NV31
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | TRGSLELCDFVTASSFCRRRLPTVLLKLRMAQHLQAAVAFVEQGHVRVGPDVVTDPAFLVTRSMEDFVTWVDSSKIKRHVLEYNEERDDFDLE |
| Documents & Links for Anti IMP3 pAb (ATL-HPA061177) | |
| Datasheet | Anti IMP3 pAb (ATL-HPA061177) Datasheet (External Link) |
| Vendor Page | Anti IMP3 pAb (ATL-HPA061177) at Atlas |
| Documents & Links for Anti IMP3 pAb (ATL-HPA061177) | |
| Datasheet | Anti IMP3 pAb (ATL-HPA061177) Datasheet (External Link) |
| Vendor Page | Anti IMP3 pAb (ATL-HPA061177) |