Anti IMMP1L pAb (ATL-HPA058308)
Atlas Antibodies
- SKU:
- ATL-HPA058308-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: IMMP1L
Alternative Gene Name: FLJ25059, IMMP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042670: 100%, ENSRNOG00000004829: 98%
Entrez Gene ID: 196294
Uniprot ID: Q96LU5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GGVVMCSGPSMEPTIQNSDIVFAENLSRHFYGIQRGDIVIAKSPSDPKSNICKR |
Gene Sequence | GGVVMCSGPSMEPTIQNSDIVFAENLSRHFYGIQRGDIVIAKSPSDPKSNICKR |
Gene ID - Mouse | ENSMUSG00000042670 |
Gene ID - Rat | ENSRNOG00000004829 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti IMMP1L pAb (ATL-HPA058308) | |
Datasheet | Anti IMMP1L pAb (ATL-HPA058308) Datasheet (External Link) |
Vendor Page | Anti IMMP1L pAb (ATL-HPA058308) at Atlas Antibodies |
Documents & Links for Anti IMMP1L pAb (ATL-HPA058308) | |
Datasheet | Anti IMMP1L pAb (ATL-HPA058308) Datasheet (External Link) |
Vendor Page | Anti IMMP1L pAb (ATL-HPA058308) |