Anti IMMP1L pAb (ATL-HPA058308)

Atlas Antibodies

SKU: ATL-HPA058308-25

• 

Protein Description: inner mitochondrial membrane peptidase subunit 1
Gene Name: IMMP1L
Alternative Gene Name: FLJ25059, IMMP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042670: 100%, ENSRNOG00000004829: 98%
Entrez Gene ID: 196294
Uniprot ID: Q96LU5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GGVVMCSGPSMEPTIQNSDIVFAENLSRHFYGIQRGDIVIAKSPSDPKSNICKR
• Gene Sequence: GGVVMCSGPSMEPTIQNSDIVFAENLSRHFYGIQRGDIVIAKSPSDPKSNICKR
• Gene ID - Mouse: ENSMUSG00000042670
• Gene ID - Rat: ENSRNOG00000004829
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.